PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009106295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 792aa    MW: 88357.1 Da    PI: 6.2973
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009106295.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.2e-29530581152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_009106295.1 530 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 581
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052518601IPR003035RWP-RK domain
PfamPF020421.2E-25533581IPR003035RWP-RK domain
SuperFamilySSF542771.84E-22684780No hitNo description
PROSITE profilePS5174529.203694777IPR000270PB1 domain
SMARTSM006661.8E-24694777IPR000270PB1 domain
PfamPF005641.5E-17695775IPR000270PB1 domain
CDDcd064074.06E-36695771No hitNo description
Gene3DG3DSA:3.10.20.2401.9E-19695774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MDSSFMDGLL LDGCWLETTT TDASEFPNFS PSTSLAPFDP SSFMWSPQQD NTAAISSSTT  60
LSHMYGQGFA ERSSLEDLST LNRRFWIGPS GGGHGSSVME RLVQAVKHIK DFTSERGDSL  120
IQLWVPVDRG GKRVLTTKEQ PFSHDPMSQR LAHYREISEN YQFSAEQEDS SSKDLVGLPG  180
RVFLGQVPEW TPDVRFFKNE EYPRVQHAQD CDVRGTLAIP VFEQGSKTCL GVIEVVMTTQ  240
MVKLSPELDS ICRALQAVDL RSTEVPVSPS LKGPDFSYQA ALPEIRNLLR CACETHKLPL  300
AQTWMSCLKQ SKTGCRHNDH NYIHCVSTID DACYVGDPTV RDFHEACSEH HLLKGQGVVG  360
EAFLTNGPCF SSDVSSYKKS EYPLSHHATM FGLHGTVAIR LRCIHTGSAD FVLEFFLPKD  420
CRDIEEQRRM LNALSTIMAH VPRSLRTVTE KELEEEGDQM VSEVETLPKI EETCEVHESS  480
SNPQHVGLAV DGEIGFDYGK GVSVVNENST FSSAGGGGSS RVTEKKKTKA EKNITLDVLR  540
QYFAGSLKDA AKSIGVCPTT LKRICRQHGI QRWPSRKIKK VGHSLQKIQR VIDSVQGVSG  600
HHLPIGSFYA NFPNLASSQE QQSKQTTFLP SSSHSQPAKS SSPGSSCSHT SSCSSETQAN  660
KEDPMNKARE DTRAIKQTQT TQLSPSTSSQ DDDFLRVKVS YEEEKIRFRM RNSRRLKDLL  720
WEIAKRFSIE DVSRYDLKYL DEDNEWVLLR CDDDVEECVD VCRSFPGETI KLLLQLSSQH  780
LQERSSVSGS LS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106295.10.0PREDICTED: protein NLP5 isoform X2
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLM4DGY20.0M4DGY2_BRARP; Uncharacterized protein
STRINGBra015758.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein